PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC036825.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family TALE
Protein Properties Length: 195aa    MW: 22560.5 Da    PI: 7.1471
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC036825.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.93.5e-081441772154
                   HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
      Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   k +yp++e++++L +++gL+ +q+ +WF N+R +
  EcC036825.20 144 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 177
                   469*****************************87 PP

2ELK29.12.3e-1098119122
           ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                   ELKh+L+++Y+++++++++E++
  EcC036825.20  98 ELKHELKQGYKEKIIDIREEIL 119
                   9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012564.6E-13141IPR005541KNOX2
PfamPF037918.6E-13240IPR005541KNOX2
SMARTSM011880.002498119IPR005539ELK domain
PROSITE profilePS512139.86598118IPR005539ELK domain
PfamPF037893.8E-598119IPR005539ELK domain
PROSITE profilePS5007111.855118181IPR001356Homeobox domain
SuperFamilySSF466891.67E-16120184IPR009057Homeodomain-like
SMARTSM003897.2E-11120185IPR001356Homeobox domain
CDDcd000863.46E-11121182No hitNo description
Gene3DG3DSA:1.10.10.603.5E-25125182IPR009057Homeodomain-like
PfamPF059206.2E-18138177IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003899Molecular FunctionDNA-directed RNA polymerase activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
THYVLLLCSF KEQLQQHVRV HAMEAVMACW EIEQSLQSLT GVSPGEGTGA TMSDDEDDQV  60
DSDANLFDVS LDGTDSLGFG PLIPTETERS LMERVRQELK HELKQGYKEK IIDIREEILR  120
KRRAGKLPGD TTSVLKQWWQ THSKWPYPTE EDKARLVQET GLQLKQINNW FINQRKRNWH  180
SNPSTSTVLK SKRKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A5e-13121185872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174194RKRNWHSNPSTSTVLKSKRKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010048923.11e-142PREDICTED: homeobox protein knotted-1-like 3 isoform X2
SwissprotP480001e-131KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A059CS961e-142A0A059CS96_EUCGR; Uncharacterized protein
TrEMBLA0A059CT021e-143A0A059CT02_EUCGR; Uncharacterized protein
TrEMBLA0A059CT331e-142A0A059CT33_EUCGR; Uncharacterized protein
STRINGVIT_04s0008g06130.t011e-135(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-125KNOTTED1-like homeobox gene 3